PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_17672g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 427aa    MW: 47520.1 Da    PI: 6.5017
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_17672g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+  ++q+G+g +W + +++ g++R++k+c++rw++yl
    MA_17672g0010 14 KGPWSPEEDAKLKAFIEQHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding33.51e-1070111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++++Ed ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
    MA_17672g0010  70 GFSEDEDSIICGLYASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.714966IPR017930Myb domain
SuperFamilySSF466893.56E-2611109IPR009057Homeodomain-like
SMARTSM007172.1E-121364IPR001005SANT/Myb domain
PfamPF002498.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-231569IPR009057Homeodomain-like
CDDcd001672.10E-91662No hitNo description
PROSITE profilePS5129415.50367117IPR017930Myb domain
SMARTSM007177.1E-967115IPR001005SANT/Myb domain
PfamPF002491.9E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAFIE QHGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPDIRHGG FSEDEDSIIC GLYASIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
RKEQQTRRFK EAKSMSNGAG PYVSEGMSAA SSTINAIRSL MSNTEALYLS DRMPHMDMDP  180
SLGLLNPQFL QHTVSNIANY CSSSEHVSFG TGPPQGLDQE LTFDNASLRK LLFRTECAFT  240
ADNNNNTSQA SPPIISSQIY SPSTILDPGL VQDSFEKSCM NINVKEEPVA GALDHHHIDY  300
LASMTLRDSC SSTEGNYIQS PWLYQNGLQD HSCLSYEFPM EQMNEGIYWN SASSSLQGHH  360
EKEELCAYSS YKESTRHADE PTTTFWGAQL PCNYPKPMSD CPNYFSVAPS DANQQGSSRS  420
QEAGIIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1091180.0BT109118.1 Picea glauca clone GQ03204_O05 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.19e-72myb domain protein 68